PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI07G19200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 369aa    MW: 40012.1 Da    PI: 7.0918
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI07G19200.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.11.2e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lv ++k++G g+W+t ++  g+ R++k+c++rw +yl
  ORUFI07G19200.1 14 KGPWTPEEDEKLVAYIKEHGQGNWRTLPKNAGLSRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.42.9e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
  ORUFI07G19200.1  67 RGRFSFEEEEAIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-26564IPR009057Homeodomain-like
PROSITE profilePS5129426.48965IPR017930Myb domain
SuperFamilySSF466899.54E-3211108IPR009057Homeodomain-like
SMARTSM007178.8E-171363IPR001005SANT/Myb domain
PfamPF002494.1E-171461IPR001005SANT/Myb domain
CDDcd001672.01E-131661No hitNo description
Gene3DG3DSA:1.10.10.602.6E-2665116IPR009057Homeodomain-like
SMARTSM007178.3E-1766114IPR001005SANT/Myb domain
PROSITE profilePS5129420.76866116IPR017930Myb domain
PfamPF002491.9E-1567111IPR001005SANT/Myb domain
CDDcd001671.05E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MGRAPCCEKS GLKKGPWTPE EDEKLVAYIK EHGQGNWRTL PKNAGLSRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEEAIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHAPRL DLLDLTSLLK PAAAAAYYPT QADLDTLRAL EPLAGYPDLL RLASAILPAA  180
TTTGAAAAAA AEQAQLLLPW LLQAQMAQQQ QQVTPPPPPP PPQAAATEQF LQATSTACHQ  240
MPGLVHASPT QQLAQQPQDH MAAATCHRRG AVQHPSYDNQ LDYVPALMQM ASDASNLQQW  300
SSTVSSSNNH NVNSGVSTPS SSPAAAGQIN SSSTTTTTTY GLNASGDVDD AGLLINMHLS  360
ELLDVSDYM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankY114150.0Y11415.1 O.sativa mRNA for myb factor, 1355 bp.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645522.10.0PREDICTED: transcription factor MYB39
SwissprotQ8GWP01e-74MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0E0Q9T80.0A0A0E0Q9T8_ORYRU; Uncharacterized protein
STRINGLOC_Os07g37210.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-86MYB-like 102